User Tools

Site Tools


data:cathdomaindescriptionfile

Differences

This shows you the differences between two versions of the page.

Link to this comparison view

Both sides previous revisionPrevious revision
Next revision
Previous revision
data:cathdomaindescriptionfile [2008/09/08 16:28] – sillitoedata:cathdomaindescriptionfile [2014/11/07 14:56] (current) – sillitoe
Line 1: Line 1:
 +====== Cath Domain Description File (CDDF) ======
 +
 +===== Format 1.0 =====
 +
 +Each entry corresponds to a CATH domain for a given release of the CATH database. 
 +Note: Different releases of CATH may have different domain definitions.
 +See below for CATH domain and segment naming conventions.
 +
 +Information is compiled from the following files:
 +  * [[CathDomainList]]
 +  * [[CathDomall]]
 +  * CathDomain Fasta Sequences
 +  * CathSegment Fasta Sequences
 +  * PdbSum file (in CDDF format)
 +  * ChainLimits file (in CDDF format)
 +
 +Comment lines start with a '#' character.
 +
 +MAXIMUM of 80 characters per line (composed of a tag that is always a maximum of 
 +10 characters; the rest of the line should be no longer than 70 characters).
 +
 +^ Tags  ^ Description  ^
 +| FORMAT   | Format definition (CDDF1.0) and first line of each entry   |
 +| DOMAIN   | CATH domain identifier - six character code (e.g. 1abc01)  |
 +| PDBID    | PDB identifier - four character code  \\ (currently only used in PdbSumData files)   |
 +| VERSION  | CATH version number          |
 +| VERDATE  | CATH version release date    |
 +| NAME    | PDB entry description         |
 +| SOURCE   | PDB entry organism/source    |
 +| CATHCODE | CATH superfamily code C.A.T.H e.g. 1.10.10.10   |
 +| CLASS    | Text description of class level (default: 'void')   |
 +| ARCH    | Text description of architecture level (default: 'void')   |
 +| TOPOL    | Text description of topology level (default: 'void')   |
 +| HOMOL    | Text description of homologous superfamily level (default: 'void')  |
 +| DLENGTH  | Length of the domain sequence    |
 +| DSEQH    | Domain sequence header in FASTA format (e.g. '>pdb%%|%%1abc01')   |
 +| DSEQS    | Domain sequence string in FASTA format    |
 +| NSEGMENTS | Number of segments that comprise the domain (integer)   |
 +| SEGMENT   | Segment identifier (e.g. 1abc01:1:2)    |
 +| SRANGE    | Start and stop PDB residue identifiers that define the range of segment \\ (e.g. START=159  STOP=202)    |
 +| SLENGTH   | Length of the segment sequence     |
 +| SSEQH     | Segment sequence header in FASTA format (e.g. '>pdb%%|%%1abc01:1:2')    |
 +| SSEQS     | Segment sequence string in FASTA format    |
 +| ENDSEG    | Signifies end of segment entry    |
 +| COMMENTS  | Text    |
 +| %%//%%    | Signifies end of entry    |
 +
 +
 +==== Example ====
 +
 +<code>
 +FORMAT    CDDF1.0
 +DOMAIN    9lprA1
 +VERSION   2.4
 +VERDATE   14-Jan-2002
 +NAME      Alpha-lytic protease complex with methoxysuccinyl- Ala- Ala- Pro- Leuc
 +NAME      ine boronic acid
 +SOURCE    (Lysobacter enzymogenes 495) cloned and expressed in (escherichia coli
 +SOURCE    )
 +CATHCODE  2.40.10.10
 +CLASS     Mainly Beta
 +ARCH      Barrel
 +TOPOL     Thrombin, subunit H
 +HOMOL     Trypsin-like serine proteases
 +DLENGTH   87
 +DSEQH     >pdb|9lprA1
 +DSEQS     IVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSA
 +DSEQS     QTLLLQPILSQYGLSLV
 +NSEGMENTS 2
 +SEGMENT   9lprA1:1:2
 +SRANGE    START=16   STOP=115
 +SLENGTH   74
 +SSEQH     >pdb|9lprA1:1:2
 +SSEQS     IVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSA
 +SSEQS     QTLL
 +ENDSEG
 +SEGMENT   9lprA1:2:2
 +SRANGE    START=231  STOP=242
 +SLENGTH   13
 +SSEQH     >pdb|9lprA1:2:2
 +SSEQS     LQPILSQYGLSLV
 +ENDSEG
 +COMMENTS  Blah Blah
 +//
 +</code>
 +
 +
 +NOTE:
 +The following CATH hierarchy description lines are typically found together 
 +(derived from CathList and CathNames files)
 +
 +<code>
 +CATHCODE  2.40.10.10
 +CLASS     Mainly Beta
 +ARCH      Barrel
 +TOPOL     Thrombin, subunit H
 +HOMOL     Trypsin-like serine proteases
 +</code>
 +
 +
 +The following domain sequence lines are typically found together 
 +(derived from CathDomain Fasta Sequence File)
 +
 +<code>
 +DLENGTH   87
 +DSEQH     >pdb|9lprA1
 +DSEQS     IVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSA
 +DSEQS     QTLLLQPILSQYGLSLV
 +</code>
 +
 +Segment sequence lines are always initiated with a 'SEGMENT' tag
 +and terminated with an 'ENDSEG' tag. The number of segments in the domain
 +always precedes the first segment using the 'NSEGMENTS' tag.
 +
 +The following segment sequence lines are typically found together
 +(derived from CathSegments Fasta Sequence File)
 +
 +
 +<code>
 +SEGMENT   9lprA1:1:2
 +SRANGE    START=16   STOP=115
 +SLENGTH   74
 +SSEQH     >pdb|9lprA1:1:2
 +SSEQS     IVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSA
 +SSEQS     QTLL
 +ENDSEG
 +</code>
 +
 +===== Cath Domain and Segment Naming Conventions =====
 +
 +==== CATH Domain Names ====
 +
 +The domain names have seven characters (e.g. 1oaiA00).
 +
 +<code>
 +CHARACTERS 1-4: PDB Code
 +The first 4 characters determine the PDB code e.g. 1oai
 +
 +CHARACTER 5: Chain Character
 +This determines which PDB chain is represented.
 +Chain characters of zero ('0') indicate that the PDB file has no chain field.
 +
 +CHARACTER 6-7: Domain Number
 +The domain number is a 2-figure, zero-padded number (e.g. '01', '02' ... '10', '11', '12'). Where the domain number is a double ZERO ('00') this indicates that the domain is a whole PDB chain with no domain chopping. 
 +</code>
 +
 +==== CATH Segment Names ====
 +
 +CATH segments (continuous regions of sequence within a domain) are described
 +adding colon separated numbers to the end of the domain name.
 +
 +The first number is the sequential number of the segment.
 +
 +The second number is the total number of segments in this domain.
 +
 +<code>
 +1abcA01:1:2
 +xxxxxxxooooo
 +
 +x = standard CATH six character domain name
 +o = segment information :ThisSegment:TotalSegments
 +</code>
 +
 +
 +